PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0026s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 235aa    MW: 26298.6 Da    PI: 8.0511
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0026s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.74.5e-20158192135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++Cg+ kTp+WR gp+g+ktLCnaCG++y++ +l
  Cagra.0026s0014.1.p 158 CQHCGAEKTPQWRAGPSGPKTLCNACGVRYKSGRL 192
                          *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.6E-17152202IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.99E-15155215No hitNo description
PROSITE profilePS5011412.281155188IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-15156190IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.53E-15157204No hitNo description
PfamPF003201.5E-17158192IPR000679Zinc finger, GATA-type
PROSITE patternPS003440158183IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEMESFMDDL LNFSVPEEEE EEDDMQPPRN LTRRKTGLRQ TDSSFGLFNS DDSGVVEEED  60
LEWISNKDAF PVIETFVGVL PPEHFRVTSP EREATEIKQL TTLMSCCVSF KAPAKARSKR  120
RRTGRRDLRV LWTGNEQGGG GGIQKKKTTA AVIIGRKCQH CGAEKTPQWR AGPSGPKTLC  180
NACGVRYKSG RLVPEYRPAN SPTFTAELHS NSHRKIVEMR KQYQSGDGDR KDCG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2274931e-121AK227493.1 Arabidopsis thaliana mRNA for GATA transcription factor 1, complete cds, clone: RAFL14-11-O16.
GenBankAP0012971e-121AP001297.1 Arabidopsis thaliana genomic DNA, chromosome 3, BAC clone:F14O13.
GenBankBT0244971e-121BT024497.1 Arabidopsis thaliana At3g24050 mRNA, complete cds.
GenBankCP0026861e-121CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankY136481e-121Y13648.1 Arabidopsis thaliana mRNA for GATA transcription factor 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298301.11e-140hypothetical protein CARUB_v10014365mg
SwissprotQ8LAU91e-124GATA1_ARATH; GATA transcription factor 1
TrEMBLR0HN961e-140R0HN96_9BRAS; Uncharacterized protein
STRINGAT3G24050.11e-122(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM129872430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.11e-117GATA transcription factor 1